A0685
FGF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A0685
- Additional Names:
- AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-1|FGF-alpha|FGF1|FGFA|GLIO703|HBGF-1|HBGF1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 17 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
- Uniprot:
- P05230
- Synonyms:
- Acidic fibroblast growth factor;AFGF;beta-endothelial cell growth factor;ECGF;ECGF-beta;ECGFA;ECGFB;Endothelial cell growth factor;endothelial cell growth factor, alpha;endothelial cell growth factor, beta;FGF-1;FGF-alpha;FGFA;fibroblast growth factor 1;fibroblast growth factor 1 (acidic);GLIO703;HBGF-1;HBGF1;heparin-binding growth factor 1
- Extra Details:
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice