A0683
STEAP3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A0683
- Additional Names:
- AHMIO2|dudlin-2|dudulin-2|pHyde|STEAP3|STMP3|TSAP6
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
- Uniprot:
- Q658P3
- Synonyms:
- AHMIO2;dudlin-2;dudulin-2;metalloreductase STEAP3;pHyde;six-transmembrane epithelial antigen of prostate 3;STEAP family member 3, metalloreductase;STMP3;TSAP6;tumor suppressor pHyde;tumor suppressor-activated pathway protein 6
- Extra Details:
- This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice