Histone H1.2 Rabbit monoclonal antibody

Size

POA

SKU:: A0646
Additional Names:: H1.2|H1C|H1F2|H1s-1|HIST1H1C|Histone H1.2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 32kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG
Uniprot:: P16403
Synonyms:: H1 histone family, member 2;H1.2;H1C;H1F2;H1s-1;HIST1H1C;histone 1, H1c;histone cluster 1 H1 family member c;histone cluster 1, H1c;histone H1.2;histone H1c;histone H1d;histone H1s-1
Extra Details:: Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Shipping Conditions:: Blue Ice