A0621
USP24 Rabbit monoclonal antibody

Size
POA
- SKU:
- A0621
- Additional Names:
- ubiquitin specific peptidase 24|USP24
- Application:
- ELISA, WB
- Molecular Weight:
- 295kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQ
- Uniprot:
- Q9UPU5
- Synonyms:
- deubiquitinating enzyme 24;ubiquitin carboxyl-terminal hydrolase 24;ubiquitin specific protease 24;ubiquitin thioesterase 24;ubiquitin thiolesterase 24;ubiquitin-specific processing protease 24;Ubiquitin-specific-processing protease 24
- Extra Details:
- Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
- Shipping Conditions:
- Blue Ice

