NUDT5 Rabbit monoclonal antibody

Size

POA

SKU:: A0609
Additional Names:: hNUDT5|NUDT5|YSA1|YSA1H|YSAH1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLID
Uniprot:: Q9UKK9
Synonyms:: 8-oxo-dGDP phosphatase;ADP-sugar pyrophosphatase;hNUDT5;nuclear ATP-synthesis protein NUDIX5;Nucleoside diphosphate-linked moiety X motif 5;nudix (nucleoside diphosphate linked moiety X)-type motif 5;YSA1;YSA1H;YSAH1
Extra Details:: This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors.