A0600
Olig3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A0600
- Additional Names:
- Bhlhb7|bHLHe20|Olig3
- Application:
- ELISA, WB
- Molecular Weight:
- 29kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK
- Uniprot:
- Q7RTU3
- Synonyms:
- Bhlhb7;bHLHe20;class B basic helix-loop-helix protein 7;class E basic helix-loop-helix protein 20;oligo3;oligodendrocyte transcription factor 3
- Extra Details:
- Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within negative regulation of transcription by RNA polymerase II; spinal cord motor neuron cell fate specification; and spinal cord motor neuron migration. Predicted to be part of chromatin. Predicted to be active in nucleus.
- Shipping Conditions:
- Blue Ice