[KO Validated] LAMP2 Rabbit monoclonal antibody

Size

POA

SKU:: A0593
Additional Names:: CD107b|DND|LAMP-2|LAMP2|LAMPB|LGP-96|LGP110
Application:: ELISA, WB, IHC-P
Molecular Weight:: 100-130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
Uniprot:: P13473
Synonyms:: CD107 antigen-like family member B;CD107b;DND;LAMP-2;LAMPB;LGP-96;LGP110;lysosome-associated membrane glycoprotein 2
Extra Details:: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins.