A0541
RALA Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A0541
- Additional Names:
- HINCONS|RAL|RALA
- Application:
- ELISA, WB
- Molecular Weight:
- 24kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
- Uniprot:
- P11233
- Synonyms:
- HINCONS;RAL;RALA Ras like proto-oncogene A;Ras family small GTP binding protein RALA;ras related GTP binding protein A;RAS-like protein A;ras-related protein Ral-A;v-ral simian leukemia viral oncogene homolog A (ras related)
- Extra Details:
- The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.
- Shipping Conditions:
- Blue Ice