EXOSC7 Rabbit monoclonal antibody

Size

POA

SKU:: A0501
Additional Names:: EAP1|EXOSC7|hRrp42p|p8|RRP42|Rrp42p
Application:: ELISA, WB
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MASVTLSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDD
Uniprot:: Q15024
Synonyms:: EAP1;exosome complex component RRP42;exosome complex exonuclease RRP42;Exosome component 7;hRrp42p;p8;ribosomal RNA-processing protein 42;RRP42;Rrp42p
Extra Details:: Predicted to enable 3'-5'-exoribonuclease activity and RNA binding activity. Predicted to be involved in RNA metabolic process. Part of exosome (RNase complex).