TSC2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0492
Additional Names:: LAM|PPP1R160|TSC2|TSC4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 200kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSV
Uniprot:: P49815
Synonyms:: LAM;PPP1R160;protein phosphatase 1, regulatory subunit 160;TSC4;tuberin;tuberous sclerosis 2 protein
Extra Details:: This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.