MAP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0453
Additional Names:: MAP-2|MAP2|MAP2A|MAP2B|MAP2C
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 220-280kd(MAP2A,MAP2B)
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKD
Uniprot:: P11137
Synonyms:: MAP-2;MAP2A;MAP2B;MAP2C;microtubule-associated protein 2
Extra Details:: This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.