A0452
MRPL28 Rabbit monoclonal antibody
Size
POA
- SKU:
- A0452
- Additional Names:
- MAAT1|MRPL28|p15
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 30kDa/30kd
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKR
- Uniprot:
- Q13084
- Synonyms:
- 39S ribosomal protein L28, mitochondrial;L28mt;MAAT1;melanoma antigen p15;melanoma-associated antigen recognised by cytotoxic T lymphocytes;melanoma-associated antigen recognized by T-lymphocytes;mitochondrial large ribosomal subunit protein bL28m;MRP-L28;p15
- Extra Details:
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion.
- Shipping Conditions:
- Blue Ice