[KO Validated] Hsc70/HSPA8 Rabbit monoclonal antibody

Size

POA

SKU:: A0415
Additional Names:: HEL-33|HEL-S-72p|HSC54|HSC70|Hsc70/HSPA8|HSC71|HSP71|HSP73|HSPA10|LAP-1|LAP1|NIP71
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 71kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
Uniprot:: P11142
Synonyms:: constitutive heat shock protein 70;epididymis luminal protein 33;epididymis secretory sperm binding protein Li 72p;Heat shock 70 kDa protein 8;heat shock 70kd protein 10;heat shock 70kDa protein 8;heat shock cognate 71 kDa protein;heat shock cognate protein 54;HEL-33;HEL-S-72p;HSC54;HSC70;HSC71;HSP71;HSP73;HSPA10;LAP-1;LAP1;lipopolysaccharide-associated protein 1;LPS-associated protein 1;N-myristoyltransferase inhibitor protein 71;NIP71
Extra Details:: This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice