A0394
PLA2G4A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0394
- Additional Names:
- cPLA2|cPLA2-alpha|GURDP|PLA2G4|PLA2G4A
- Application:
- ELISA, WB
- Molecular Weight:
- 115kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA
- Uniprot:
- P47712
- Synonyms:
- calcium-dependent phospholipid-binding protein;cPLA2;cPLA2-alpha;cytosolic phospholipase A2;GURDP;lysophospholipase;phosphatidylcholine 2-acylhydrolase;Phospholipase A2 group IVA;phospholipase A2, group IVA (cytosolic, calcium-dependent);PLA2G4
- Extra Details:
- This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandins and leukotrienes, are lipid-based cellular hormones that regulate hemodynamics, inflammatory responses, and other intracellular pathways. The hydrolysis reaction also produces lysophospholipids that are converted into platelet-activating factor. The enzyme is activated by increased intracellular Ca(2+) levels and phosphorylation, resulting in its translocation from the cytosol and nucleus to perinuclear membrane vesicles. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

