A0345
MDM2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0345
- Additional Names:
- ACTFS|hdm2|HDMX|LSKB|MDM2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 90kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWL
- Uniprot:
- Q00987
- Synonyms:
- ACTFS;Double minute 2 protein;double minute 2, human homolog of; p53-binding protein;E3 ubiquitin-protein ligase Mdm2;hdm2;HDMX;LSKB;MDM2 oncogene, E3 ubiquitin protein ligase;MDM2 proto-oncogene, E3 ubiquitin protein ligase;Mdm2, p53 E3 ubiquitin protein ligase homolog;Mdm2, transformed 3T3 cell double minute 2, p53 binding protein;oncoprotein Mdm2;p53-binding protein Mdm2;RING-type E3 ubiquitin transferase Mdm2
- Extra Details:
- This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
- Shipping Conditions:
- Blue Ice



