Src Rabbit polyclonal antibody

Size

£152.00

SKU:: A0324
Additional Names:: ASV|c-SRC|p60-Src|Src|SRC1|THC6
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Uniprot:: P12931
Synonyms:: ASV;c-SRC;p60-Src;pp60c-src;proto-oncogene c-Src;proto-oncogene tyrosine-protein kinase Src;protooncogene SRC, Rous sarcoma;SRC1;THC6;tyrosine kinase pp60c-src;tyrosine-protein kinase SRC-1;v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
Extra Details:: This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.