iNOS Rabbit polyclonal antibody

Size

£152.00

SKU:: A0312
Additional Names:: HEP-NOS|INOS|NOS|NOS2A
Application:: ELISA, WB
Molecular Weight:: 130 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAV
Uniprot:: P35228
Synonyms:: HEP-NOS;hepatocyte NOS;inducible NO synthase;inducible NOS;INOS;nitric oxide synthase 2, inducible;nitric oxide synthase 2A (inducible, hepatocytes);nitric oxide synthase, inducible;nitric oxide synthase, macrophage;NOS;NOS type II;NOS, type II;NOS2A;peptidyl-cysteine S-nitrosylase NOS2
Extra Details:: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.