A0279
VCAM1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A0279
- Additional Names:
- CD106|INCAM-100|VCAM1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 95-120 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL
- Uniprot:
- P19320
- Synonyms:
- CD106;CD106 antigen;INCAM-100;vascular cell adhesion protein 1
- Extra Details:
- This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice