A0261
OLFM1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A0261
- Additional Names:
- AMY|NOE1|NOELIN1|OlfA|OLFM1
- Application:
- ELISA, WB
- Molecular Weight:
- 72kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVT
- Uniprot:
- Q99784
- Synonyms:
- AMY;neuroblastoma protein;neuronal olfactomedin-related ER localized protein;NOE1;noelin;NOELIN1;OlfA;olfactomedin related ER localized protein;Olfactomedin-1;pancortin 1
- Extra Details:
- This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice