IKKE Epsilon Rabbit polyclonal antibody

Size

£152.00

SKU:: A0244
Additional Names:: IKK-E|IKK-i|IKKE|IKKI|IKKE Epsilon
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
Uniprot:: Q14164
Synonyms:: I-kappa-B kinase epsilon;IKK-E;IKK-epsilon;IKK-i;IKK-related kinase epsilon;IKKE;IKKI;inducible I kappa-B kinase;inducible IkappaB kinase;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon;inhibitor of nuclear factor kappa-B kinase subunit epsilon
Extra Details:: IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).