[KD Validated] ERK1 Rabbit polyclonal antibody

Size

POA

SKU:: A0228
Additional Names:: ERK-1|ERK1|ERT2|HS44KDAP|HUMKER1A|K1|p44-ERK1|p44-MAPK|P44ERK1|P44MAPK|PRKM3
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV
Uniprot:: P27361
Synonyms:: ERK-1;ERK1;ERT2;extracellular signal-regulated kinase 1;extracellular signal-related kinase 1;HS44KDAP;HUMKER1A;insulin-stimulated MAP2 kinase;MAP kinase isoform p44;MAPK 1;microtubule-associated protein 2 kinase;mitogen-activated protein kinase 3;p44-ERK1;p44-MAPK;P44ERK1;P44MAPK;PRKM3
Extra Details:: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.

Shipping Conditions:: Blue Ice