A0216
Caspase-10 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A0216
- Additional Names:
- ALPS2|Caspase-10|FLICE-2|FLICE2|MCH4
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALS
- Uniprot:
- Q92851
- Synonyms:
- ALPS2;apoptotic protease MCH-4;CASP-10;caspase 10 apoptosis-related cysteine peptidase;caspase 10, apoptosis-related cysteine protease;caspase-10;FADD-like ICE2;FAS-associated death domain protein interleukin-1B-converting enzyme 2;FLICE-2;FLICE2;ICE-like apoptotic protease 4;interleukin-1B-converting enzyme 2;MCH4
- Extra Details:
- This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with type IIA autoimmune lymphoproliferative syndrome, non-Hodgkin lymphoma and gastric cancer. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice