A0202
ATF6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0202
- Additional Names:
- ACHM7|ATF6|ATF6A
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 90-100 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
- Uniprot:
- P18850
- Synonyms:
- ACHM7;Activating transcription factor 6 alpha;ATF6A;cAMP-dependent transcription factor ATF-6 alpha;cyclic AMP-dependent transcription factor ATF-6 alpha
- Extra Details:
- This gene encodes a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. It functions as an ER stress sensor/transducer, and following ER stress-induced proteolysis, it functions as a nuclear transcription factor via a cis-acting ER stress response element (ERSE) that is present in the promoters of genes encoding ER chaperones. This protein has been identified as a survival factor for quiescent but not proliferative squamous carcinoma cells. There have been conflicting reports about the association of polymorphisms in this gene with diabetes in different populations, but another polymorphism has been associated with increased plasma cholesterol levels. This gene is also thought to be a potential therapeutic target for cystic fibrosis.
- Shipping Conditions:
- Blue Ice






_IHC_01.jpg)
_IHC_02.jpg)
_IHC_03.jpg)