Bcl10 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0191
Additional Names:: Bcl10|c-E10|CARMEN|CIPER|CLAP|IMD37|mE10
Application:: ELISA, WB
Molecular Weight:: 32kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLK
Uniprot:: O95999
Synonyms:: B cell CLL/lymphoma 10;B-cell CLL/lymphoma 10;B-cell lymphoma/leukemia 10;c-E10;CARD containing molecule enhancing NF-kB;CARD-containing apoptotic signaling protein;CARD-containing molecule enhancing NF-kappa-B;CARD-containing proapoptotic protein;CARD-like apoptotic protein;CARMEN;caspase-recruiting domain-containing protein;cCARMEN;CED-3/ICH-1 prodomain homologous E10-like regulator;cellular homolog of vCARMEN;cellular-E10;CIPER;CLAP;hCLAP;IMD37;mammalian CARD-containing adapter molecule E10;mE10
Extra Details:: This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice