A0186
CaMK2 delta/CAMK2 gamma Rabbit monoclonal antibody
Size
POA
- SKU:
- A0186
- Additional Names:
- CAM2|CAMK2|CaMK2 delta/CAMK2 gamma|CAMKB|CaMKIIbeta|MRD54
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 60 kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
- Uniprot:
- Q13555, Q13557
- Synonyms:
- calcium/calmodulin-dependent protein kinase (CaM kinase) II delta;calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma;calcium/calmodulin-dependent protein kinase type II delta chain;calcium/calmodulin-dependent protein kinase type II subunit delta;calcium/calmodulin-dependent protein kinase type II subunit gamma;CaM kinase II delta subunit;CaM-kinase II delta chain;CAMK;CAMK-II;CaMK-II delta subunit;caMK-II subunit gamma;CAMKD;CAMKG;MRD59
- Extra Details:
- The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice