GDF15 Rabbit polyclonal antibody

Size

£152.00

SKU:: A0185
Additional Names:: GDF-15|GDF15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Uniprot:: Q99988
Synonyms:: GDF-15;growth/differentiation factor 15;macrophage inhibitory cytokine 1;MIC-1;MIC1;NAG-1;non-steroidal anti-inflammatory drug-activated gene-1;NRG-1;NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1;NSAID-activated gene 1 protein;NSAID-regulated gene 1 protein;PDF;PLAB;placental bone morphogenetic protein;placental TGF-beta;prostate differentiation factor;PTGF-beta;PTGFB
Extra Details:: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.

Shipping Conditions:: Blue Ice