A0131
PSD95 Rabbit monoclonal antibody
Size
POA
- SKU:
- A0131
- Additional Names:
- MRD62|PSD95|SAP-90|SAP90
- Application:
- ELISA, WB
- Molecular Weight:
- 95 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII
- Uniprot:
- P78352
- Synonyms:
- discs large homolog 4;disks large homolog 4;MRD62;post-synaptic density protein 95;Postsynaptic density protein 95;PSD95;SAP-90;SAP90;synapse-associated protein 90;Tax interaction protein 15
- Extra Details:
- This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice