A0062
CYP1A2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A0062
- Additional Names:
- CP12|CYP1A2|CYPIA2|P3-450|P450(PA)
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE
- Uniprot:
- P05177
- Synonyms:
- aryl hydrocarbon hydroxylase;cholesterol 25-hydroxylase;CP12;CYPIA2;cytochrome P(3)450;cytochrome P450 1A2;cytochrome P450 4;cytochrome P450-P3;cytochrome P450, family 1, subfamily A, polypeptide 2;cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 2;dioxin-inducible P3-450;flavoprotein-linked monooxygenase;hydroperoxy icosatetraenoate dehydratase;microsomal monooxygenase;P3-450;P450 form 4;P450(PA);xenobiotic monooxygenase
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region.
- Shipping Conditions:
- Blue Ice







