Cytokeratin 4 (KRT4) Rabbit monoclonal antibody

Size

POA

SKU:: A0013
Additional Names:: CK-4|CK4|CYK4|Cytokeratin 4 (KRT4)|K4|WSN1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
Uniprot:: P19013
Synonyms:: CK-4;CK4;CYK4;cytokeratin 4;Cytokeratin-4;K4;keratin 4, type II;Keratin-4;keratin, type II cytoskeletal 4;type-II keratin Kb4;WSN1
Extra Details:: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.