Human Recombinant Alpha Synuclein (1-114) PFFs (C-terminal Truncated)

Eine Lieferung in diese Region ist nicht möglich.

SKU:: SPR-537
Zusätzliche Namen:: A Alpha-Synuclein (1-114), Alpha Synuclein 1-114 Truncated, C-Terminally Truncated Alpha-Synuclein, Alpha-Synuclein Fragment (1-114), SNCA (1-114) Fibrillar Protein, SNCA (1-114) Protein, Alpha-Synuclein Fragment 1-114, Seeding-Competent Alpha-Synuclein (1-114) Fibrils, Alpha-Synuclein (1-114) Aggregation Seeds
Anwendung:: FuncS
Konzentration:: 2 mg/ml
Molekulargewicht:: 11.46 kDa
Reinheit:: >95%
Aufreinigung:: Ion Exchange
Lagerbedingungen:: -70[o]C
Hersteller:: StressMarq Biosciences
Buffer:: PBS
Spezies:: Human
Sequenz:: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILE
Uniprot:: P37840
Synonyme:: alpha-synuclein;I+/--synuclein;NACP;non A-beta component of AD amyloid;Non-A beta component of AD amyloid;Non-A4 component of amyloid precursor;PARK1;PARK4;PD1;synuclein alpha-140;synuclein, alpha (non A4 component of amyloid precursor);truncated alpha synuclein
Weitere Details:: Human recombinant alpha-synuclein (1-114) is a C-terminally truncated form of A Alpha-synuclein lacking residues 115-140. C-terminal truncation is a pathological modification observed in synucleinopathies, including Parkinson's disease and dementia with Lewy bodies, and has been associated with increased aggregation and fibril formation relative to the full-length protein. Cleavage at residue Glu114 has been identified as a major physiological processing event of A Alpha-synuclein aggregates, and the resulting 1-114 species has been detected in disease-associated inclusions. Studies suggest that truncation of the C-terminal region alters A Alpha-synuclein conformation and promotes the formation of aggregation-prone species that may contribute to the development and progression of A Alpha-synuclein pathology. StressMarq's Alpha Synuclein (1-114) Pre-Formed Fibrils (PFFs) (C-Term Truncated) have been demonstrated to seed monomers in an in-vitro Thioflavin T seeding assay.

Versandbedingungen:: Dry Ice