6489
Recombinant Mouse IL-1 beta

Größe
£261.00
- SKU:
- 6489
- Physischer Zustand:
- Lyophilized
- Molekulargewicht:
- 17.4 kDa
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- ImmunoChemistry Technologies
- Format:
- Recombinant proteins produced in yeast
- Sequenz:
- VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)
- Weitere Details:
- IL-1 beta (IL-1B Beta) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast., ICT
- Versandbedingungen:
- Ambient
