GTX54831
GIRK1 antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX54831
- Zusätzliche Namen:
- potassium inwardly-rectifying channel, subfamily J, member 3 , GIRK-1 , GIRK1 , Kcnf3 , Kir3.1
- Anwendung:
- IHC, WB, IF, ICC, IP
- Konzentration:
- 0.6 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human, Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 0.05% Sodium azide.
- Immunogen:
- GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 ( Intracellular, C-terminus) of mouse GIRK1 (Accession : P63250), (MW: 34 kDa.).
- Uniprot:
- P63250
- Synonyme:
- G protein-activated inward rectifier potassium channel 1;G protein-gated K+ channel subunit 1 GIRK1;GIR;GIRK-1;GIRK1;inward rectifier K(+) channel Kir3.1;Kcnf;Kcnf3;Kcnj1;Kir3;Kir3.1;potassium channel, inwardly rectifying subfamily J member 3
- Versandbedingungen:
- Blue Ice