GTX54775
KCNJ1 / ROMK antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX54775
- Zusätzliche Namen:
- potassium voltage-gated channel subfamily J member 1 , KAB-1 , Kcnj , Kcnj1_v1 , Kcnj1_v3 , ROMK1 , ROMK2 , ROMK3 , kir1.1
- Anwendung:
- WB, IHC-Fr, IF, ICC, IP
- Konzentration:
- 0.8 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human, Rat
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 0.025% Sodium azide.
- Immunogen:
- GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 ( Intracellular, C-terminus) of rat KCNJ1 (Accession : P35560), (MW: 33 kDa).
- Synonyme:
- ATP-regulated potassium channel ROM-K;ATP-sensitive inward rectifier potassium channel 1;inward rectifier K(+) channel Kir1.1;K+ channel protein;KAB-1;Kcnj;Kcnj1_v1;Kcnj1_v3;kir1.1;potassium channel, inwardly rectifying subfamily J member 1;potassium voltage-gated channel subfamily J member 1, variant 1;potassium voltage-gated channel subfamily J member 1, variant 3;ROMK1;ROMK2;ROMK3
- Weitere Details:
- potassium channel involved in K+ secretion in the renal distal nephron [RGD, Feb 2006]
- Versandbedingungen:
- Blue Ice