GTX45117
SDF1 alpha antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX45117
- Zusätzliche Namen:
- chemokine (C-X-C motif) ligand 12 , Pbsf , Scyb12 , Sdf1 , Tlsf , Tpar1
- Anwendung:
- IHC, WB, IHC-P, IP
- Konzentration:
- 1 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Protein A Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Buffer:
- PBS, 0.1% Sodium azide.
- Immunogen:
- Recombinant protein was generated using E. coli-expressed mouse SDF-1A Alpha as an immunogen.The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Uniprot:
- P40224
- Synonyme:
- 12-O-tetradecanoylphorbol 13-acetate repressed protein 1;C-X-C motif chemokine 12;PB;Pbsf;PBSF/SD;Pre-B cell growth-stimulating factor;pre-B-cell growth-stimulating factor;Scyb1;Scyb12;Sdf;SDF-;Sdf1;stromal cell-derived factor 1;thymic lymphoma cell-stimulating factor;TLS;Tlsf;TP;Tpar1
- Weitere Details:
- This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
- Versandbedingungen:
- Blue Ice