![AMH antibody [5/6]](https://www.genetex.com/upload/website/prouct_img/normal/GTX42793/GTX42793_79_IHC-P_w_23060820_192.webp)
GTX42793
AMH antibody [5/6]
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX42793
- Zusätzliche Namen:
- anti-Mullerian hormone , MIF , MIS
- Anwendung:
- WB, IHC-P
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Crude Cell Culture Supernatant
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Mouse
- Reaktivitäten:
- Human, Mouse, Ovine
- Buffer:
- Tissue culture supernatant, 0.1% Sodium azide.
- Immunogen:
- Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
- Klon:
- 5/6
- Uniprot:
- P03971
- Synonyme:
- anti-Muellerian hormone;MIF;MIS;muellerian-inhibiting factor;muellerian-inhibiting substance;Mullerian inhibiting factor;Mullerian inhibiting substance
- Weitere Details:
- This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2016]
- Versandbedingungen:
- Blue Ice