GTX13268
IL21 Receptor antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX13268
- Zusätzliche Namen:
- interleukin 21 receptor , NILR
- Anwendung:
- ELISA, Flow Cytometry, IHC
- Konzentration:
- 1 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Buffer:
- 10mM KHPO₄, 140mM NaCl, 0.1% BSA, 0.1% Sodium azide.
- Immunogen:
- Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor
- Uniprot:
- Q9JHX3
- Synonyme:
- IL-21 receptor;IL-21R;interleukin-21 receptor;LR-beta;lymphocyte receptor beta;NILR;novel cytokine receptor 8;novel interleukin receptor;NR8
- Versandbedingungen:
- Blue Ice