GTX05101
TEFM antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX05101
- Zusätzliche Namen:
- C17orf42,TEFM,transcription elongation factor, mitochondrial
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the N-terminal region of Human TEFM (RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ).
- Uniprot:
- Q96QE5
- Synonyme:
- C17orf42;transcription elongation factor of mitochondria;transcription elongation factor, mitochondrial
- Versandbedingungen:
- Blue Ice