GTX05085
C11orf82 antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX05085
- Zusätzliche Namen:
- C11orf82,DDIAS,DNA damage induced apoptosis suppressor,noxin,Noxin
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide derived from the C-terminal region of human DDIAS: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS
- Uniprot:
- Q8IXT1
- Synonyme:
- C11orf82;DNA damage-induced apoptosis suppressor protein;nitric oxide-inducible gene protein;noxin
- Weitere Details:
- Involved in negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and regulation of DNA stability. Predicted to be active in cytoplasm and nucleus. [provided by Alliance of Genome Resources, Jul 2025]
- Versandbedingungen:
- Blue Ice