GTX04915
PARP11 antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX04915
- Zusätzliche Namen:
- ARTD11,C12orf6,MIB006,PARP11,poly(ADPribose) polymerase family member 11,poly(ADP-ribose) polymerase family member 11
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the middle region of human PARP11 : IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD
- Uniprot:
- Q9NR21
- Synonyme:
- ADP-ribosyltransferase diphtheria toxin-like 11;ARTD11;C12orf6;MIB006;poly [ADP-ribose] polymerase 11;protein mono-ADP-ribosyltransferase PARP11
- Versandbedingungen:
- Blue Ice