GTX04842
ZXDA antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX04842
- Zusätzliche Namen:
- ZNF896,ZXDA,zinc finger, Xlinked, duplicated A,zinc finger X-linked duplicated A
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the middle region of human ZXDA, within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV.
- Uniprot:
- P98168
- Synonyme:
- zinc finger protein 896;zinc finger X-linked protein ZXDA;ZNF896
- Versandbedingungen:
- Blue Ice