GTX04827
LRRC15 antibody

Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX04827
- Zusätzliche Namen:
- LIB,LRRC15,leucine rich repeat containing 15
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 2% Sucrose, 0.09% Sodium Azide.
- Immunogen:
- A synthetic peptide directed towards the N terminal region of human LRRC15: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
- Uniprot:
- Q8TF66
- Synonyme:
- hLib;leucine-rich repeat protein induced by beta amyloid;leucine-rich repeat protein induced by beta-amyloid homolog;leucine-rich repeat-containing protein 15;LIB
- Versandbedingungen:
- Blue Ice



