GTX04574
METTL4 antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX04574
- Zusätzliche Namen:
- methyltransferase like 4 , HsT661
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human, Rat
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Buffer:
- PBS, 2% sucrose, 0.09% Sodium Azide.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS .
- Uniprot:
- Q8N3J2
- Synonyme:
- HsT661;methyltransferase like 4;methyltransferase-like protein 4;N(6)-adenine-specific DNA methyltransferase METTL4;N(6)-adenine-specific methyltransferase METTL4;snRNA (2'-O-methyladenosine-N(6)-)-methyltransferase METTL4
- Weitere Details:
- Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus. [provided by Alliance of Genome Resources, Apr 2022]
- Versandbedingungen:
- Blue Ice