GTX03719
AHR antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX03719
- Zusätzliche Namen:
- aryl hydrocarbon receptor , bHLHe76
- Anwendung:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
- Uniprot:
- P35869
- Synonyme:
- ah receptor;AH-receptor;aromatic hydrocarbon receptor;aryl hydrocarbon receptor;bHLHe76;class E basic helix-loop-helix protein 76;RP85
- Weitere Details:
- The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes. [provided by RefSeq, Sep 2015]
- Versandbedingungen:
- Blue Ice