Rab11A antibody [4H9]

Eine Lieferung in diese Region ist nicht möglich.

SKU:: GTX03669
Zusätzliche Namen:: RAB11A, member RAS oncogene family , YL8
Anwendung:: Flow Cytometry, WB, IHC-P, IF, ICC
Konzentration:: 0.5 mg/ml
Physischer Zustand:: Liquid
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
Hersteller:: Genetex
Host:: Mouse
Reaktivitäten:: Human, Mouse, Rat
Buffer:: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, no preservatives.
Immunogen:: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
Klon:: 4H9
Uniprot:: P62491
Synonyme:: RAB 11A, member oncogene family;rab-11;ras-related protein Rab-11A;YL8
Weitere Details:: The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]