GTX03467
Lysozyme antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX03467
- Zusätzliche Namen:
- lysozyme , LYZF1 , LZM
- Anwendung:
- WB, IHC-P, IF, ICC
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa; NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
- Uniprot:
- P61626
- Synonyme:
- 1,4-beta-N-acetylmuramidase C;c-type lysozyme;lysozyme C;lysozyme F1;LYZF1;LZM
- Weitere Details:
- This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014]
- Versandbedingungen:
- Blue Ice