GTX01088
MEFV antibody
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- GTX01088
- Zusätzliche Namen:
- MEFV innate immuity regulator, pyrin , FMF , MEF , MEFV , Mediterranean fever , TRIM20
- Anwendung:
- WB
- Konzentration:
- 0.5 mg/ml
- Physischer Zustand:
- Liquid
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Hersteller:
- Genetex
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Buffer:
- 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).
- Uniprot:
- O15553
- Synonyme:
- FMF;marenostrin;Mediterranean fever;MEF;MEFV, pyrin innate immunity regulator;PAAND;pyrin;TRIM20
- Weitere Details:
- This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq, Jul 2008]
- Versandbedingungen:
- Blue Ice