U4101-06E-APC

USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (APC)

Größe

£927.00

SKU:: U4101-06E-APC
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa 466-566 from human USP21 (NP_036607) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D10
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: USP21 is a ubiquitin-specific protease, an enzyme that removes ubiquitin from ubiquitinated proteins. The encoded protein belongs to the C19 peptidase family, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. This protein has been reported to be capable of removing NEDD8 from NEDD8 conjugates. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.