R2022-03A-FITC

RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2) (FITC)

Größe

£934.00

SKU:: R2022-03A-FITC
Anwendung:: WB
Reinheit:: Purified.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: RNASE2 (NP_002925.1, 1-161aa) full-length human protein.
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: Eosinophil derived neurotoxin (EDN) is a protein belonging to the ribonuclease (RNase) A superfamily. It has recently been found to have antiviral activity against respiratory syncytial virus and human immunodeficiency virus in vitro. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.