Resistin, aa33-90 (RETN, Adipose tissue-specific secretory factor, ADSF, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, FIZZ3, HXCP1, MGC126603, MGC126609, Resistin, RETN1, RSTN, UNQ407/PRO1199, XCP1) (Not for Export EU)

Größe

£315.00

SKU:: R1585-23D
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic human Resistin (aa 33-90) bTG-conjugated (CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMD WTGARCCRVQP)
Format:: Supplied as a lyophilized powder in 50mM Tris, pH 7.2. Reconstitute in ddH2O.
Weitere Details:: It has been suggested that the hormone resistin secreted by adipocytes, links obesity to type 2 diabetes by modulating steps in the insulin-signaling pathway and inducing insulin resistance. Levels of circulating resistin decrease following treatment with the anti diabetic drug rosiglitazone and increase in diet-induced and genetic forms of obesity. In addition, treatment of normal mice with recombinant resistin impairs glucose tolerance and insulin action. Insulin-stimulated glucose uptake by adipocytes is enhanced by neutralization of resistin and is reduced by resistin treatment. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.