P3109-10H
Parathyroid Hormone, aa1-38 (PTH, Parathormone, Parathyrin)
Größe
£351.00
- SKU:
- P3109-10H
- Reinheit:
- Purified by Protein G affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Synthetic human PTH (aa 1-38) polylysine conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG)
- Klon:
- B2-82
- Format:
- Supplied as a lyophilized powder in 50mM Tris, pH 7.2. Reconstitute with sterile dH2O.
- Weitere Details:
- Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 1ug/ml Immunohistochemistry: 2ug/ml. Frozen, paraffin RIA: 25ng/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice